PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597691.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 834aa    MW: 92472 Da    PI: 4.8863
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597691.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.9e-2099154156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++e+e+lF+++++p+ ++r +L++ lgL+ rqVk+WFqNrR+++k
  XP_009597691.1  99 KKRYHRHTARQIQEMEALFKECPHPDDKQRLKLSQDLGLKPRQVKFWFQNRRTQMK 154
                     688899***********************************************998 PP

2START154.49.2e-493045274206
                     HHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
           START   4 eeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     ++ ++elvk+ +a++p+W +    + g+evl  +e s+               ++ea r s+vv+m++ +lv  lld + +W e ++    +a+t
  XP_009597691.1 304 LSSMDELVKMCQAADPLWIRTT--DSGKEVLNVEEYSRMfpwpvgikqnsneLRIEATRSSAVVIMNSITLVDALLDAN-KWIELFPsiisRAKT 395
                     6789*****************9..5566666665555556666679999999***************************.*************** PP

                     EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                     ++v++sg      g lqlm++e+qal+plvp R+ +f+Ry++q  ++g+w+ivd  +ds  ++   +++   ++++Sg++i++++ng+s+vtwve
  XP_009597691.1 396 IQVVTSGvsghasGSLQLMFMEMQALTPLVPtRECYFLRYCQQnVEEGTWAIVDFPLDSLHNNF-PAPFSYFKRRLSGCIIQDMPNGYSRVTWVE 489
                     *******************************************99***************9998.58888888********************** PP

                     -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++ + +++++ v+sg+a+ga++w+  lqrqce+
  XP_009597691.1 490 QAEVEENPVNQIFNQYVSSGMAFGAQRWLGILQRQCER 527
                     ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.3E-1889157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-2093161IPR009057Homeodomain-like
PROSITE profilePS5007116.58496156IPR001356Homeobox domain
SMARTSM003895.8E-1997160IPR001356Homeobox domain
PfamPF000461.1E-1799154IPR001356Homeobox domain
CDDcd000866.00E-1899157No hitNo description
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084841.584292530IPR002913START domain
SuperFamilySSF559612.33E-32293529No hitNo description
CDDcd088751.99E-112296526No hitNo description
SMARTSM002341.9E-30301527IPR002913START domain
PfamPF018522.7E-41304527IPR002913START domain
SuperFamilySSF559616.18E-18553723No hitNo description
SuperFamilySSF559616.18E-18756795No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MFGDCQLFSS MGMGGSAVSS DSLYSSPIQN PNFNFMAMGG NNLPFNIFPP NIIPKEENGL  60
LKSKEEMDSG SGSEHIEGMS GNELETEQQQ QQQQQLGKKK RYHRHTARQI QEMEALFKEC  120
PHPDDKQRLK LSQDLGLKPR QVKFWFQNRR TQMKAQQDRA DNVILRAEND NLKNENYRLQ  180
AALRSIMCPS CGGPAMLGEM GYDEQQLRLE NARLKEEFER VCCLVSQYNG RGPMQGIGPT  240
TPLLPPPLEL DMSINFSRKF EEPMANCSAD MVPVPFMPEN NSQFSGGGPI ILEEEKSIAM  300
ELGLSSMDEL VKMCQAADPL WIRTTDSGKE VLNVEEYSRM FPWPVGIKQN SNELRIEATR  360
SSAVVIMNSI TLVDALLDAN KWIELFPSII SRAKTIQVVT SGVSGHASGS LQLMFMEMQA  420
LTPLVPTREC YFLRYCQQNV EEGTWAIVDF PLDSLHNNFP APFSYFKRRL SGCIIQDMPN  480
GYSRVTWVEQ AEVEENPVNQ IFNQYVSSGM AFGAQRWLGI LQRQCERLAS LMARNISDLG  540
VIPSPEARKS LMNLAQRMIK TFCMNISTSC GQSWTALSDS LEDTVRITTR KVTEPGQPNG  600
LILCAVSTTW IPYNHFQVFD LLRDERRRAQ LDVLSNGNSL HEVAHIANGS HPGNCISLLR  660
INVASNSSQS VELMLQESCT DDSGSLVAYT TVDVDAIQLA MNGEDPSCIP LLPLGFVITP  720
VGQINNLDTN ISPSEANSGT QSAEKRNLSI QESGSGGCLL TVGLQVLAST IPTAKLNLSS  780
VTAINHHLCN TVQQITAALS AFYPEPAITV PSPQLQTQQQ QLEPKQADEI SSNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597691.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_009597692.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_009597693.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A0V0IWB50.0A0A0V0IWB5_SOLCH; Putative homeobox-leucine zipper protein HDG5-like
STRINGSolyc08g076370.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90202226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7